PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma1g01330.1
Common NameZOSMA_1G01330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family HB-other
Protein Properties Length: 324aa    MW: 36958.1 Da    PI: 4.9744
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma1g01330.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.31.3e-08262309653
                     S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
        Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                     +++k q+++Le+++++++ p+ ++   +   ++L+ +++  WF  +R 
  Zosma1g01330.1 262 KLKKMQVQVLEKVYHRTKRPTDAMVSSIVYVTHLPRKRIIKWFEDKRV 309
                     67899***************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE patternPS00018098110IPR018247EF-Hand 1, calcium-binding site
PROSITE profilePS500719.07254314IPR001356Homeobox domain
SMARTSM003892.1E-4256318IPR001356Homeobox domain
SuperFamilySSF466893.72E-9257311IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.9E-8262309IPR009057Homeodomain-like
PfamPF000463.6E-6262309IPR001356Homeobox domain
CDDcd000866.31E-6262308No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002229Biological Processdefense response to oomycetes
GO:0009414Biological Processresponse to water deprivation
GO:0009682Biological Processinduced systemic resistance
GO:0009787Biological Processregulation of abscisic acid-activated signaling pathway
GO:0010118Biological Processstomatal movement
GO:0050832Biological Processdefense response to fungus
GO:0098869Biological Processcellular oxidant detoxification
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000071Biological Processregulation of defense response by callose deposition
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0004601Molecular Functionperoxidase activity
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MACYSPSCCG LHRLGFHGLD GGGKRRAVTL PLPLQHLVVR QLQFQRSSSI FTAFARRKKL  60
VQEQRVEGKE EGGVDEDAFE ALFSQLEEDL KNDEISIDEN DDDEISEEDL ANLEKELEEA  120
FGDVDLDELS SSNIPSSENI DSDDEAEEIR PKLKNWQLRR LASAFKIGRR KTNIKSLSAE  180
LGLDRSFVLE MLRNPPSDLL LLSASLPDIV LKQPVQIENK FIEEEEDPSP IVEPLVEPIV  240
KPDSEAKTPI RLIQSRWSTE KKLKKMQVQV LEKVYHRTKR PTDAMVSSIV YVTHLPRKRI  300
IKWFEDKRVE DGIPVKLKAF QRM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010648647.12e-83PREDICTED: retrotransposon-like protein 1
RefseqXP_010914896.16e-84PREDICTED: uncharacterized protein LOC105040183
RefseqXP_010914898.16e-84PREDICTED: uncharacterized protein LOC105040183
TrEMBLA0A0K9PPL10.0A0A0K9PPL1_Z
STRINGVIT_04s0008g05190.t013e-85(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP107003542
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.13e-45overexpressor of cationic peroxidase 3